PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000317209
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 255aa    MW: 28875.3 Da    PI: 8.001
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000317209genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W +eEde l  +vk +G g+W+ +a++ g++R++k+c++rw++yl
    MDP0000317209 14 RGAWCAEEDEVLTXYVKTHGEGQWRHVAKKAGLNRSGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding506.7e-1667109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+ ++eE++l+++++k+lG++ W++Ia +++ gRt++++k++w+
    MDP0000317209  67 RGNISPEEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNFWN 109
                      7899******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.661961IPR017930Myb domain
SuperFamilySSF466893.17E-3011108IPR009057Homeodomain-like
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
PfamPF002495.6E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-231568IPR009057Homeodomain-like
CDDcd001674.02E-101661No hitNo description
PROSITE profilePS5129423.97762116IPR017930Myb domain
SMARTSM007177.6E-1566114IPR001005SANT/Myb domain
PfamPF002492.6E-1467109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2369116IPR009057Homeodomain-like
CDDcd001674.56E-1171109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MGRKPSGDTD GLKRGAWCAE EDEVLTXYVK THGEGQWRHV AKKAGLNRSG KSCRLRWLNY  60
LKPGVKRGNI SPEEEDLIIR LHKLLGNRWS LIAGRLPGRT DNEIKNFWNI SLSKRIQEER  120
PQRIINNKQA PNAGDSHHQR GNYCSNPSKD EDGQSNPVKS NPVALSDISD DRDQNSSLSF  180
LRDFDSYIHG LSHEAEINGF XNYVVDDSNF VGHGNGTKCE DLVLREDAEA AKWKXEERFY  240
NVSGTRDGTP YVIIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009361730.11e-165PREDICTED: transcription factor WER-like
TrEMBLA0A0U3KA513e-70A0A0U3KA51_PRUPE; R2r3-myb transcription factor (Fragment)
STRINGVIT_11s0016g01320.t013e-58(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1785547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-53myb domain protein 66